3zkc/1/1:A/1:B

Sequences

>3zkc-a1-m1-cA (length=61) [Search sequence]

IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTL L

>3zkc-a1-m1-cB (length=63) [Search sequence]

MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHT LLD

Structure information

PDB ID	3zkc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the master regulator for biofilm formation SinR in complex with DNA.
Assembly ID	1
Resolution	3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	23430750

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P06533	P06533
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation	BioLiP:3zkcA	BioLiP:3zkcB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3zkc-a1-m1-cA_3zkc-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3zkc-assembly1.cif.gz