3zu6/1/1:A/1:B

Sequences

>3zu6-a1-m1-cA (length=250) [Search sequence]

MIVFTDLDGTLLDERGELGPAREALERLRALGVPVVPVTAKTRKEVEALGLEPPFIVENG
GGLYLPRDWPVRAGRPKGGYRVVSLAWPYRKVRARLREAEALAGRPILGYGDLTAEAVAR
LTGLSREAARRAKAREYDETLVLCPEEVEAVLEALEAVGLEWTHGGRFYHAAKGADKGRA
VARLRALWPDPEEARFAVGLGDSLNDLPLFRAVDLAVYVGRGDPPEGVLATPAPGPEGFR
YAVERYLLPR

>3zu6-a1-m1-cB (length=252) [Search sequence]

Structure information

PDB ID	3zu6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The 3-dimensional structure of MpgP from Thermus thermophilus HB27, in complex with the alpha-mannosylglycerate and orthophosphate reaction products.
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	47
Sequence identity between the two chains	1.0
PubMed citation	21961705

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q72K29	Q72K29
Species	262724 (Thermus thermophilus HB27)	262724 (Thermus thermophilus HB27)
Function annotation	BioLiP:3zu6B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3zu6-a1-m1-cA_3zu6-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3zu6-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3ztw/1/1:B/1:A 3zty/1/1:A/1:B 3zup/1/1:A/1:B 3zw7/1/1:A/1:B 3zwd/1/1:A/1:B 3zwk/1/1:A/1:B 3zx4/1/1:A/1:B 3zx5/1/1:A/1:B