3zy1/1/2:A/4:A

Sequences
>3zy1-a1-m2-cA (length=40) [Search sequence]
DELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQ
>3zy1-a1-m4-cA (length=40) [Search sequence]
DELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQ
Structure information
PDB ID 3zy1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the human p63 tetramerization domain
Assembly ID 1
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession Q9H3D4 Q9H3D4
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3zy1-a1-m2-cA_3zy1-a1-m4-cA.pdb.gz
Full biological assembly
Download: 3zy1-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3zy1/1/1:A/3:A 4a9z/1/1:B/1:A
Other dimers with similar sequences but different poses
  • 3zy1/1/1:A/4:A 3zy1/1/2:A/3:A 4a9z/1/1:A/1:C 4a9z/1/1:D/1:B 7z73/1/1:C/1:A 7z73/1/1:D/1:B
  • 7z73/1/1:D/1:C 4a9z/1/1:D/1:C
  • [Back to Home]