3zyr/1/1:A/1:B

Sequences

>3zyr-a1-m1-cA (length=240) [Search sequence]

STDSLSFSFINFDRDERNLIFQGDAHTSRNNILQLTRTDSNGAPVRSTVGRILHSAQVRL
WEKSTNRVANLQTQFSFFLSSPLSNPADGIAFFIAPPDTTIPSGSAGGLLGLFNPRTALN
ESANQVLAVEFDTFFAQNSNTWDPNYQHIGIDVNSIRSSKVVRWERREGKTLNVLVTYNP
STRTIDVVATYPDGQRYQLSHVVDLTTILPEWVRVGFSAASGEQFQTHNLESWSFTSTLL

>3zyr-a1-m1-cB (length=241) [Search sequence]

Structure information

PDB ID	3zyr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the lectin from Platypodium elegans in complex with heptasaccharide
Assembly ID	1
Resolution	1.65Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	56
Sequence identity between the two chains	1.0
PubMed citation	22692206

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	G1EUI6	G1EUI6
Species	115002 (Platypodium elegans)	115002 (Platypodium elegans)
Function annotation	BioLiP:3zyrA	BioLiP:3zyrB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3zyr-a1-m1-cA_3zyr-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3zyr-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3zvx/1/1:B/1:A 5u38/1/1:A/2:A