4a34/2/1:M/1:Q

Sequences
>4a34-a2-m1-cM (length=140) [Search sequence]
LKHIPKNISPDLLKTLMEMGHGDEIVLADANYPSASCANKLIRCDGVNIPELLDSILYLM
PLDSYVDSSIQFMNVVSGDDIPKIWGTYRQMIEGHGTDLKTITYLRREDFYERSKKAYAI
VATGETSLYANIILKKGVVV
>4a34-a2-m1-cQ (length=140) [Search sequence]
LKHIPKNISPDLLKTLMEMGHGDEIVLADANYPSASCANKLIRCDGVNIPELLDSILYLM
PLDSYVDSSIQFMNVVSGDDIPKIWGTYRQMIEGHGTDLKTITYLRREDFYERSKKAYAI
VATGETSLYANIILKKGVVV
Structure information
PDB ID 4a34 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the fucose mutarotase in complex with L-fucose from Streptococcus pneumoniae
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
PubMed citation 22139157
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID M Q
UniProt accession A0A0H2ZNZ5 A0A0H2ZNZ5
Species 170187 (Streptococcus pneumoniae TIGR4) 170187 (Streptococcus pneumoniae TIGR4)
Function annotation BioLiP:4a34M BioLiP:4a34Q
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4a34-a2-m1-cM_4a34-a2-m1-cQ.pdb.gz
Full biological assembly
Download: 4a34-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4a34/1/1:A/1:J 4a34/1/1:B/1:F 4a34/1/1:C/1:G 4a34/1/1:D/1:H 4a34/1/1:E/1:I 4a34/2/1:K/1:T 4a34/2/1:L/1:P 4a34/2/1:N/1:R 4a34/2/1:O/1:S
Other dimers with similar sequences but different poses
  • 4a34/2/1:R/1:S 4a34/1/1:A/1:B 4a34/1/1:B/1:C 4a34/1/1:C/1:D 4a34/1/1:E/1:A 4a34/1/1:E/1:D 4a34/1/1:F/1:G 4a34/1/1:F/1:J 4a34/1/1:G/1:H 4a34/1/1:H/1:I 4a34/1/1:J/1:I 4a34/2/1:K/1:L 4a34/2/1:K/1:O 4a34/2/1:L/1:M 4a34/2/1:M/1:N 4a34/2/1:N/1:O 4a34/2/1:P/1:Q 4a34/2/1:P/1:T 4a34/2/1:Q/1:R 4a34/2/1:S/1:T
  • 4a34/2/1:N/1:S 4a34/1/1:A/1:F 4a34/1/1:B/1:G 4a34/1/1:C/1:H 4a34/1/1:D/1:I 4a34/1/1:E/1:J 4a34/2/1:K/1:P 4a34/2/1:L/1:Q 4a34/2/1:M/1:R 4a34/2/1:O/1:T
    		•

    [Back to Home]