4a47/2/1:B/3:B

Sequences
>4a47-a2-m1-cB (length=63) [Search sequence]
TIQLTVPTMDCTSCAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGH
EVE
>4a47-a2-m3-cB (length=63) [Search sequence]
TIQLTVPTMDCTSCAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGH
EVE
Structure information
PDB ID 4a47 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crosstalk between Cu(I) and Zn(II) homeostasis
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
PubMed citation 24050657
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession P73213 P73213
Species 1148 (Synechocystis sp. PCC 6803) 1148 (Synechocystis sp. PCC 6803)
Function annotation BioLiP:4a47B BioLiP:4a47B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4a47-a2-m1-cB_4a47-a2-m3-cB.pdb.gz
Full biological assembly
Download: 4a47-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2xmj/1/1:B/1:A 2xmk/1/1:A/1:B 2xmm/1/1:A/1:B 4a46/1/1:A/1:B 4a46/1/1:C/1:D 4a47/1/1:A/2:A 4a47/3/1:C/2:C 4a47/4/1:D/3:D
Other dimers with similar sequences but different poses
  • 2xmt/1/1:A/1:B 2xmu/1/1:A/1:B
  • 2xmv/1/1:E/1:F 2xmv/1/1:A/1:B 2xmv/1/1:A/1:C 2xmv/1/1:B/1:C 2xmv/1/1:D/1:E 2xmv/1/1:D/1:F
  • 2xmv/1/1:A/1:F 2xmv/1/1:B/1:E 2xmv/1/1:C/1:D
    		•

    [Back to Home]