4a6h/1/1:D/1:A

Sequences
>4a6h-a1-m1-cD (length=106) [Search sequence]
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEH
SRKSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
>4a6h-a1-m1-cA (length=108) [Search sequence]
HPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTE
HSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
Structure information
PDB ID 4a6h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Slm1-PH domain in complex with Inositol-4- phosphate
Assembly ID 1
Resolution 1.449Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 22574179
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession P40485 P40485
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:4a6hD BioLiP:4a6hA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4a6h-a1-m1-cD_4a6h-a1-m1-cA.pdb.gz
Full biological assembly
Download: 4a6h-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4a6h/1/1:C/1:B 4a6k/1/1:D/1:A
Other dimers with similar sequences but different poses
  • 4a5k/1/1:C/1:D 4a5k/1/1:A/1:B 4a5k/1/1:C/1:B 4a5k/1/1:D/1:A
  • 4a6h/1/1:D/1:B 4a6h/1/1:C/1:A 4a6k/1/1:D/1:B
  • 4a6h/1/1:A/1:B 4a6k/1/1:A/1:B
  • [Back to Home]