4adz/1/2:A/2:B

Sequences
>4adz-a1-m2-cA (length=90) [Search sequence]
YHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRH
CVADAALKGGTEIDAKVEEATKAIGRLLRT
>4adz-a1-m2-cB (length=90) [Search sequence]
YHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRH
CVADAALKGGTEIDAKVEEATKAIGRLLRT
Structure information
PDB ID 4adz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the apo form of a Copper-sensitive operon Regulator (CsoR) protein from Streptomyces lividans
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 76
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession D6EK73 D6EK73
Species 1916 (Streptomyces lividans) 1916 (Streptomyces lividans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4adz-a1-m2-cA_4adz-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4adz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4adz/1/1:A/1:B 4uig/1/1:A/4:A 4uig/1/2:A/3:A
Other dimers with similar sequences but different poses
  • 4uig/1/3:A/4:A 4adz/1/1:A/2:A 4adz/1/1:B/2:B 4uig/1/1:A/2:A
  • [Back to Home]