4aea/2/1:B/2:B

Sequences
>4aea-a2-m1-cB (length=67) [Search sequence]
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTD
NCNPFPT
>4aea-a2-m2-cB (length=67) [Search sequence]
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTD
NCNPFPT
Structure information
PDB ID 4aea (database links: RCSB PDB PDBe PDBj PDBsum)
Title Dimeric alpha-cobratoxin X-ray structure: Localization of intermolecular disulfides and possible mode of binding to nicotinic acetylcholine receptors
Assembly ID 2
Resolution 1.94Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 113
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P01391 P01391
Species 8649 (Naja kaouthia) 8649 (Naja kaouthia)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4aea-a2-m1-cB_4aea-a2-m2-cB.pdb.gz
Full biological assembly
Download: 4aea-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2ctx/1/1:A/2:A 1ctx/1/1:A/2:A
  • 6zfm/1/1:E/1:A 6zfm/1/1:B/1:D
  • [Back to Home]