4afl/3/1:D/1:E

Sequences
>4afl-a3-m1-cD (length=90) [Search sequence]
YLEHYLDSIENLPFELQRNFQLRDLDQRTEDLKAEIDKLATEYSLSSEEKLALLKQIQEA
YGKCKEFGDDKVQLAQTYEVDKHIRRLDTD
>4afl-a3-m1-cE (length=96) [Search sequence]
GYLEHYLDSIENLPFELQRNFQLRDLDQRTEDLKAEIDKLATEYSSARSLSSEEKLALLK
QIQEAYGKCKEFGDDKVQLAQTYEVDKHIRRLDTDL
Structure information
PDB ID 4afl (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the ING4 dimerization domain reveals the functional organization of the ING family of chromatin binding proteins.
Assembly ID 3
Resolution 2.275Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 87
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession Q9UNL4 Q9UNL4
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4afl-a3-m1-cD_4afl-a3-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4afl-assembly3.cif.gz
Similar dimers

[Back to Home]