4aj5/1/1:P/1:L

Sequences
>4aj5-a1-m1-cP (length=105) [Search sequence]
HMEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHNPVTLLKELSVIKSRYQTLYARFKP
VAVEQKESKSRICATVKKTMNMIQKLQKQTDLSPLTKEEKTAAEQ
>4aj5-a1-m1-cL (length=106) [Search sequence]
HMEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNNPVTLLKELSVIKSRYQTLYARFKPV
AVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQ
Structure information
PDB ID 4aj5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Ska core complex
Assembly ID 1
Resolution 3.32Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID P L
UniProt accession Q8WVK7 Q8WVK7
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4aj5-a1-m1-cP_4aj5-a1-m1-cL.pdb.gz
Full biological assembly
Download: 4aj5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4aj5/1/1:K/1:T 4aj5/1/1:R/1:O 4aj5/1/1:S/1:M
Other dimers with similar sequences but different poses
  • 4aj5/1/1:S/1:T 4aj5/1/1:K/1:M 4aj5/1/1:L/1:R 4aj5/1/1:L/1:S 4aj5/1/1:N/1:K 4aj5/1/1:N/1:O 4aj5/1/1:P/1:M 4aj5/1/1:P/1:O 4aj5/1/1:Q/1:R 4aj5/1/1:Q/1:T
  • [Back to Home]