4aj5/1/1:S/1:T

Sequences

>4aj5-a1-m1-cS (length=107) [Search sequence]

GHMEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPVTLLKELSVIKSRYQTLYARFKP VAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQ

>4aj5-a1-m1-cT (length=110) [Search sequence]

HMEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHNPVTLLKELSVIKSRYQTLYARFKP VAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKF

Structure information

PDB ID	4aj5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Ska core complex
Assembly ID	1
Resolution	3.32Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	17
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	S	T
UniProt accession	Q8WVK7	Q8WVK7
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4aj5-a1-m1-cS_4aj5-a1-m1-cT.pdb.gz

Full biological assembly Download: 4aj5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4aj5/1/1:K/1:M 4aj5/1/1:L/1:R 4aj5/1/1:L/1:S 4aj5/1/1:N/1:K 4aj5/1/1:N/1:O 4aj5/1/1:P/1:M 4aj5/1/1:P/1:O 4aj5/1/1:Q/1:R 4aj5/1/1:Q/1:T
Other dimers with similar sequences but different poses	4aj5/1/1:P/1:L 4aj5/1/1:K/1:T 4aj5/1/1:R/1:O 4aj5/1/1:S/1:M