4alp/1/4:D/2:B

Sequences
>4alp-a1-m4-cD (length=84) [Search sequence]
VLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFT
FKKSSKGFESLRVTGPGGNPCLGN
>4alp-a1-m2-cB (length=86) [Search sequence]
QVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEF
TFKKSSKGFESLRVTGPGGNPCLGNE
Structure information
PDB ID 4alp (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Lin28b Cold shock domain in complex with hexauridine
Assembly ID 1
Resolution 1.48Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
PubMed citation 22570413
Chain information
Chain 1 Chain 2
Model ID 4 2
Chain ID D B
UniProt accession B4F6I0 B4F6I0
Species 8364 (Xenopus tropicalis) 8364 (Xenopus tropicalis)
Function annotation BioLiP:4alpD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4alp-a1-m4-cD_4alp-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4alp-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4alp/1/1:C/1:A 4alp/1/1:D/1:B 4alp/1/2:C/4:A
Other dimers with similar sequences but different poses
  • 3ulj/3/2:A/2:B 3ulj/3/1:A/1:B
  • 3ulj/3/1:A/2:B 3ulj/3/2:A/1:B
  • [Back to Home]