4aqj/1/1:A/2:A

Sequences
>4aqj-a1-m1-cA (length=96) [Search sequence]
SNTQAERSIIGMIDMFHKYTRRDGKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEK
KDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
>4aqj-a1-m2-cA (length=96) [Search sequence]
SNTQAERSIIGMIDMFHKYTRRDGKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEK
KDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Structure information
PDB ID 4aqj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of human S100A7 D24G bound to zinc and calcium
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 77
Sequence identity between the two chains 1.0
PubMed citation 22747601
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P31151 P31151
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4aqjA BioLiP:4aqjA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4aqj-a1-m1-cA_4aqj-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4aqj-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1psr/1/1:A/1:B 2psr/1/1:A/2:A 2wnd/1/1:A/2:A 2wor/1/1:A/2:A 2wos/1/1:A/2:A 3psr/1/1:A/1:B 4aqi/1/1:A/2:A

[Back to Home]