4ass/1/1:B/1:C

Sequences
>4ass-a1-m1-cB (length=90) [Search sequence]
FYTLNIAEIAERIGNDDCAYQVLAFINENGEAQLNKTAVAEIQLSKPTVFATVNSFYCAG
YIDETRVGRSKIYTLSDLGVEIVECFKQKA
>4ass-a1-m1-cC (length=90) [Search sequence]
FYTLNIAEIAERIGNDDCAYQVLAFINENGEAQLNKTAVAEIQLSKPTVFATVNSFYCAG
YIDETRVGRSKIYTLSDLGVEIVECFKQKA
Structure information
PDB ID 4ass (database links: RCSB PDB PDBe PDBj PDBsum)
Title TubR bound to tubC - 26 bp - from Bacillus thuringiensis serovar israelensis pBtoxis
Assembly ID 1
Resolution 7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q8KNP2 Q8KNP2
Species 1428 (Bacillus thuringiensis) 1428 (Bacillus thuringiensis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4ass-a1-m1-cB_4ass-a1-m1-cC.pdb.gz
Full biological assembly
Download: 4ass-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ass/1/1:D/1:E 4ass/1/1:F/1:G 4ass/1/1:H/1:I
Other dimers with similar sequences but different poses
  • 3m9a/1/1:A/2:A 3m8e/1/1:B/1:A 3m8f/1/1:A/1:B 4aso/1/1:A/1:B 4aso/2/1:C/1:D 4aso/3/1:E/1:F 4aso/4/1:G/1:H 4aso/5/1:I/1:J 4aso/6/1:K/1:L 4aso/7/1:M/1:N 4aso/8/1:O/1:P 4ass/1/1:A/1:B 4ass/1/1:C/1:D 4ass/1/1:E/1:F 4ass/1/1:G/1:H
  • [Back to Home]