4auq/1/1:B/1:E

Sequences

>4auq-a1-m1-cB (length=57) [Search sequence]

QLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

>4auq-a1-m1-cE (length=57) [Search sequence]

QLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Structure information

PDB ID	4auq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of BIRC7-UbcH5b-Ub complex.
Assembly ID	1
Resolution	2.176Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	62
Sequence identity between the two chains	1.0
PubMed citation	22902369

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	E
UniProt accession	Q96CA5	Q96CA5
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4auqB	BioLiP:4auqE

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4auq-a1-m1-cB_4auq-a1-m1-cE.pdb.gz

Full biological assembly Download: 4auq-assembly1.cif.gz