4auv/2/5:G/3:C

Sequences
>4auv-a2-m5-cG (length=27) [Search sequence]
SECVSEMLDLEKQFSELKEKLFRERLS
>4auv-a2-m3-cC (length=35) [Search sequence]
SEDYERRRSECVSEMLDLEKQFSELKEKLFRERLS
Structure information
PDB ID 4auv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the BRMS1 N-terminal region
Assembly ID 2
Resolution 1.999Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 23500495
Chain information
Chain 1 Chain 2
Model ID 5 3
Chain ID G C
UniProt accession Q9HCU9 Q9HCU9
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4auvC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4auv-a2-m5-cG_4auv-a2-m3-cC.pdb.gz
Full biological assembly
Download: 4auv-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4auv/1/1:A/2:A 4auv/1/1:B/2:B 4auv/2/4:G/1:C
Other dimers with similar sequences but different poses
  • 2xus/1/2:B/3:B 2xus/1/1:A/2:A 2xus/1/1:A/3:A 2xus/1/1:B/2:B 2xus/1/1:B/3:B 2xus/1/2:A/3:A
  • 4auv/1/2:B/1:A 4auv/1/1:B/2:A 4auv/2/1:C/3:C 4auv/2/4:G/5:G 4auv/3/1:C/3:C 4auv/4/1:G/6:G
  • 4auv/3/3:H/3:C 4auv/1/1:D/1:A 4auv/1/2:D/2:A 4auv/2/1:H/1:C 4auv/2/3:H/3:C 4auv/3/1:H/1:C
  • 4auv/2/1:H/5:G 4auv/1/1:D/1:B 4auv/1/2:D/2:B 4auv/2/3:H/4:G
  • 4auv/1/2:D/2:E 4auv/1/1:D/1:E
  • [Back to Home]