4axi/1/3:B/2:A

Sequences
>4axi-a1-m3-cB (length=115) [Search sequence]
TEESKQRVIQEYVPGKQVTLAHIIANPNEDIYKKLGLVLDKKDAIGILTITPSEASIIAA
DVATKASNVSLGFIDRFSGSVVISGDVSSVESALNDVLEVLGNMLNFSSTKITRT
>4axi-a1-m2-cA (length=116) [Search sequence]
TEESKQRVIQEYVPGKQVTLAHIIANPNEDIYKKLGLVLDKKDAIGILTITPSEASIIAA
DVATKASNVSLGFIDRFSGSVVISGDVSSVESALNDVLEVLGNMLNFSSTKITRTL
Structure information
PDB ID 4axi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Clostridium difficile EutS protein
Assembly ID 1
Resolution 1.51Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 2
Chain ID B A
UniProt accession Q187M0 Q187M0
Species 272563 (Clostridioides difficile 630) 272563 (Clostridioides difficile 630)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4axi-a1-m3-cB_4axi-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4axi-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4axi/1/1:B/3:A 4axi/1/2:B/1:A
Other dimers with similar sequences but different poses
  • 4axi/1/3:B/3:A 4axi/1/1:B/1:A 4axi/1/1:B/2:A 4axi/1/2:B/2:A 4axi/1/2:B/3:A 4axi/1/3:B/1:A
  • [Back to Home]