4aya/1/1:B/1:A

Sequences

>4aya-a1-m1-cB (length=48) [Search sequence]

LLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSH

>4aya-a1-m1-cA (length=59) [Search sequence]

DDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHLKPSFL

Structure information

PDB ID	4aya (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of ID2 HLH homodimer at 2.1A resolution
Assembly ID	1
Resolution	2.103Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	61
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q02363	Q02363
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4aya-a1-m1-cB_4aya-a1-m1-cA.pdb.gz

Full biological assembly Download: 4aya-assembly1.cif.gz