4b0f/1/1:C/1:E

Sequences
>4b0f-a1-m1-cC (length=47) [Search sequence]
PEGCEQVLTGKRLQCLPNPEDVKALEVYKLSLEIEQLELQRDSARQS
>4b0f-a1-m1-cE (length=53) [Search sequence]
ETPEGCEQVLTGKRLQCLPNPEDVKALEVYKLSLEIEQLELQRDSARQSTLDK
Structure information
PDB ID 4b0f (database links: RCSB PDB PDBe PDBj PDBsum)
Title Heptameric core complex structure of C4b-binding (C4BP) protein from human
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 60
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C E
UniProt accession P04003 P04003
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4b0f-a1-m1-cC_4b0f-a1-m1-cE.pdb.gz
Full biological assembly
Download: 4b0f-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4b0f/1/1:B/1:D 4b0f/1/1:C/1:A 4b0f/1/1:E/1:G 4b0f/1/1:F/1:A 4b0f/1/1:F/1:D

[Back to Home]