4b5d/1/1:D/1:E

Sequences

>4b5d-a1-m1-cD (length=211) [Search sequence]

NGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTF
KAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFS
NGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLE
ILENSAQRQEVVYPCCESAYVEMKYLLALRS

>4b5d-a1-m1-cE (length=211) [Search sequence]

Structure information

PDB ID	4b5d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Capitella teleta AChBP in complex with psychonicline (3-((2(S)- Azetidinyl)methoxy)-5-((1S,2R)-2-(2-hydroxyethyl)cyclopropyl)pyridine)
Assembly ID	1
Resolution	2.195Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0
PubMed citation	22928944

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	I6L8L2	I6L8L2
Species	283909 (Capitella teleta)	283909 (Capitella teleta)
Function annotation	BioLiP:4b5dD	BioLiP:4b5dE

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4b5d-a1-m1-cD_4b5d-a1-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4b5d-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4afg/1/1:A/1:B 4afg/1/1:A/1:E 4afg/1/1:B/1:C 4afg/1/1:C/1:D 4afg/1/1:D/1:E 4afh/1/1:A/1:B 4afh/1/1:B/1:C 4afh/1/1:C/1:D 4afh/1/1:E/1:A 4afh/1/1:E/1:D 4b5d/1/1:A/1:B 4b5d/1/1:A/1:E 4b5d/1/1:B/1:C 4b5d/1/1:C/1:D