4b6j/1/1:D/2:D

Sequences

>4b6j-a1-m1-cD (length=200) [Search sequence]

GAMDPQFMKKVAVIDIEGTLTDFEFWREMARITGKREIEELLEKGLSGEVEWLDSLLKRV
GLIRGIDEGTFLRTREKVNVSPEARELVETLREKGFKVVLISGSFEEVLEPFKELGDEFM
ANRAIFEDGKFQGIRLRFRDKGEFLKRFRDGFILAMGDGYADAKMFERADMGIAVGREIP
GADLLVKDLKELVDFIKNLK

>4b6j-a1-m2-cD (length=200) [Search sequence]

Structure information

PDB ID	4b6j (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of phosphoserine phosphatase from T. onnurineus
Assembly ID	1
Resolution	3.34Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	57
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	D	D
UniProt accession	B6YX36	B6YX36
Species	523850 (Thermococcus onnurineus NA1)	523850 (Thermococcus onnurineus NA1)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4b6j-a1-m1-cD_4b6j-a1-m2-cD.pdb.gz

Full biological assembly

Download:

4b6j-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4ap9/1/1:A/2:B 4ap9/1/1:B/3:A 4ap9/1/2:A/4:B 4ap9/1/3:B/4:A 4ap9/2/1:C/6:D 4ap9/2/1:D/7:C 4ap9/2/5:C/7:D 4ap9/2/5:D/6:C 4b6j/1/1:A/1:C 4b6j/1/1:B/2:B 4b6j/1/2:A/2:C

Other dimers with similar sequences but different poses

4ap9/2/7:C/7:D 4ap9/1/1:A/1:B 4ap9/1/2:A/2:B 4ap9/1/3:A/3:B 4ap9/1/4:A/4:B 4ap9/2/1:C/1:D 4ap9/2/5:C/5:D 4ap9/2/6:C/6:D 4b6j/1/1:A/1:D 4b6j/1/1:B/1:C 4b6j/1/2:A/2:D 4b6j/1/2:B/2:C

4ap9/2/5:C/7:C 4ap9/1/1:A/2:A 4ap9/1/1:A/3:A 4ap9/1/1:B/2:B 4ap9/1/1:B/3:B 4ap9/1/2:A/4:A 4ap9/1/2:B/4:B 4ap9/1/3:A/4:A 4ap9/1/3:B/4:B 4ap9/2/1:C/6:C 4ap9/2/1:C/7:C 4ap9/2/1:D/6:D 4ap9/2/1:D/7:D 4ap9/2/5:C/6:C 4ap9/2/5:D/6:D 4ap9/2/5:D/7:D 4b6j/1/1:A/1:B 4b6j/1/1:A/2:D 4b6j/1/1:B/2:C 4b6j/1/1:C/1:D 4b6j/1/1:C/2:B 4b6j/1/1:D/2:A 4b6j/1/2:A/2:B 4b6j/1/2:C/2:D