4ba9/2/1:E/2:F

Sequences

>4ba9-a2-m1-cE (length=104) [Search sequence]

GPHMHKKSFFDKKRSERASNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLI EEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ

>4ba9-a2-m2-cF (length=104) [Search sequence]

GPHMHKKSFFDKKRSERASNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLI EEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ

Structure information

PDB ID	4ba9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1
Assembly ID	2
Resolution	2.73Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	E	F
UniProt accession	Q9UBZ9	Q9UBZ9
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4ba9-a2-m1-cE_4ba9-a2-m2-cF.pdb.gz

Full biological assembly Download: 4ba9-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4ba9/1/1:A/1:C 4ba9/1/1:B/1:D 4ba9/2/1:F/2:E