4bem/1/1:H/1:I

Sequences
>4bem-a1-m1-cH (length=81) [Search sequence]
EGLDFIKACSAIGAGIAMIAGVGPGIGQGFAAGKGAEAVGRQPEAQSDIIRTMLLGAAVA
ETTGIYGLIVALILLFANPFF
>4bem-a1-m1-cI (length=81) [Search sequence]
EGLDFIKACSAIGAGIAMIAGVGPGIGQGFAAGKGAEAVGRQPEAQSDIIRTMLLGAAVA
ETTGIYGLIVALILLFANPFF
Structure information
PDB ID 4bem (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the F-type ATP synthase c-ring from Acetobacterium woodii.
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 197
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H I
UniProt accession H6LFT2 H6LFT2
Species 931626 (Acetobacterium woodii DSM 1030) 931626 (Acetobacterium woodii DSM 1030)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4bem-a1-m1-cH_4bem-a1-m1-cI.pdb.gz
Full biological assembly
Download: 4bem-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4bem/1/1:A/1:B 4bem/1/1:B/1:C 4bem/1/1:C/1:D 4bem/1/1:D/1:E 4bem/1/1:E/1:F 4bem/1/1:F/1:G 4bem/1/1:G/1:H

[Back to Home]