4bg7/1/1:B/1:A

Sequences

>4bg7-a1-m1-cB (length=88) [Search sequence]

VDDQSIILWEKEGEQVRLTVSEFRGNLYMGIRYWLLDINDEWFPTKSGFSFPYTLETTSQ LFYAFTQILSESEVLHEVQKRAEELKAK

>4bg7-a1-m1-cA (length=98) [Search sequence]

EQVNQNYEGHVDDQSIILWEKEGEQVRLTVSEFRGNLYMGIRYWLLDINDEWFPTKSGFS FPYTLETTSQLFYAFTQILSESEVLHEVQKRAEELKAK

Structure information

PDB ID	4bg7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Bacteriophage T5 Homolog of the Eukaryotic Transcription Coactivator PC4 Implicated in Recombination-Dependent DNA Replication
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	124
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q6QGH2	Q6QGH2
Species	10726 (Tequintavirus T5)	10726 (Tequintavirus T5)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4bg7-a1-m1-cB_4bg7-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4bg7-assembly1.cif.gz