4bhu/1/1:H/1:F

Sequences
>4bhu-a1-m1-cH (length=123) [Search sequence]
GPLGSASLFATITGASTEWSFSDIELTYRPNTLLSLGVEFTLPSGFTANTKDTNGNALRT
TQILNNGKTVRVPLALDLLGAGEFLKLNNKTLPAAGTYTFRAENKSLSIGNFYAEASIDV
AKR
>4bhu-a1-m1-cF (length=125) [Search sequence]
GPLGSASLFATITGASTEWSFSDIELTYRPNTLLSLGVEFTLPSGFTANTKDTNGNALRT
TQILNNGKTVRVPLALDLLGAGEFLKLNNKTLPAAGTYTFRAENKSLSIGNFYAEASIDV
AKRST
Structure information
PDB ID 4bhu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of BslA - A bacterial hydrophobin
Assembly ID 1
Resolution 1.91Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H F
UniProt accession P71014 P71014
Species 535026 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10) 535026 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4bhu-a1-m1-cH_4bhu-a1-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4bhu-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4bhu/1/1:A/1:G 4bhu/1/1:B/1:D 4bhu/1/1:C/1:E
Other dimers with similar sequences but different poses
  • 4bhu/1/1:H/1:E 4bhu/1/1:A/1:D 4bhu/1/1:C/1:F 4bhu/1/1:G/1:B
  • 4bhu/1/1:A/1:H 4bhu/1/1:B/1:C 4bhu/1/1:D/1:E 4bhu/1/1:G/1:F
  • 4bhu/1/1:H/1:C 4bhu/1/1:G/1:D
  • 4bhu/1/1:J/1:A 4bhu/1/1:I/1:B
  • 4bhu/1/1:J/1:G 4bhu/1/1:I/1:D
  • 4bhu/1/1:J/1:F 4bhu/1/1:I/1:E
    		•

    [Back to Home]