4bhv/1/1:A/1:D

Sequences
>4bhv-a1-m1-cA (length=57) [Search sequence]
YDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISIHHH
>4bhv-a1-m1-cD (length=58) [Search sequence]
YDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISIHHHH
Structure information
PDB ID 4bhv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Measles virus phosphoprotein tetramerization domain
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession P35974 P35974
Species 11234 (Measles morbillivirus) 11234 (Measles morbillivirus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4bhv-a1-m1-cA_4bhv-a1-m1-cD.pdb.gz
Full biological assembly
Download: 4bhv-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4bhv/1/1:A/1:C 4bhv/1/1:B/1:C 4bhv/1/1:B/1:D
Other dimers with similar sequences but different poses
  • 4c5q/2/1:G/1:H 3zdo/1/1:E/1:F 3zdo/1/1:E/1:H 3zdo/1/1:G/1:F 3zdo/1/1:H/1:G 3zdo/2/1:A/1:D 3zdo/2/1:B/1:A 4c5q/1/1:B/1:A 4c5q/1/1:C/1:B 4c5q/1/1:C/1:D 4c5q/1/1:D/1:A 4c5q/2/1:F/1:E 4c5q/2/1:G/1:F 4c5q/2/1:H/1:E 6htl/1/1:A/3:A 6htl/1/1:A/4:A 6htl/1/2:A/3:A 6htl/1/2:A/4:A
  • [Back to Home]