4bif/2/1:E/1:H

Sequences
>4bif-a2-m1-cE (length=131) [Search sequence]
MEIKRVGSQASGKGPADWFTGTVRIDPLFQAPDPALVAGASVTFEPGARTAWHTHPLGQT
LIVTAGCGWAQREGGAVEEIHPGDVVWFSPGEKHWHGAAPTTAMTHLAIQERLDGKAVDW
MEHVTDEQYRR
>4bif-a2-m1-cH (length=131) [Search sequence]
MEIKRVGSQASGKGPADWFTGTVRIDPLFQAPDPALVAGASVTFEPGARTAWHTHPLGQT
LIVTAGCGWAQREGGAVEEIHPGDVVWFSPGEKHWHGAAPTTAMTHLAIQERLDGKAVDW
MEHVTDEQYRR
Structure information
PDB ID 4bif (database links: RCSB PDB PDBe PDBj PDBsum)
Title Biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria
Assembly ID 2
Resolution 2.46Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 23981508
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E H
UniProt accession E8WYN5 E8WYN5
Species 1198114 (Granulicella tundricola MP5ACTX9) 1198114 (Granulicella tundricola MP5ACTX9)
Function annotation BioLiP:4bifE BioLiP:4bifH
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4bif-a2-m1-cE_4bif-a2-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4bif-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4bif/1/1:A/1:D 4bif/1/1:B/1:C 4bif/2/1:F/1:G
Other dimers with similar sequences but different poses
  • 4uxa/9/1:K/1:L 4bif/1/1:A/1:B 4bif/1/1:C/1:D 4bif/2/1:E/1:F 4bif/2/1:G/1:H 4uxa/10/1:I/1:J 4uxa/1/1:S/1:T 4uxa/2/1:E/1:F 4uxa/3/1:Q/1:R 4uxa/4/1:G/1:H 4uxa/5/1:O/1:P 4uxa/6/1:M/1:N 4uxa/7/1:C/1:D 4uxa/8/1:A/1:B
  • 4bif/2/1:F/1:H 4bif/1/1:A/1:C 4bif/1/1:B/1:D 4bif/2/1:E/1:G
  • [Back to Home]