4bj8/1/1:F/1:G

Sequences

>4bj8-a1-m1-cF (length=118) [Search sequence]

SCNVTGVWRNELGSTLRVKAEGSEVRGVYQTAVESTRGAAGHHRSARIIGMVSDGTQPTV SFSVLWEKGSCSAWVGQCFILDDGAQVLKTFWMLRSVADNLASAWGSTRMGEDIFFKT

>4bj8-a1-m1-cG (length=119) [Search sequence]

SSCNVTGVWRNELGSTLRVKAEGSEVRGVYQTAVESTRGAAGHHRSARIIGMVSDGTQPT VSFSVLWEKGSCSAWVGQCFILDDGAQVLKTFWMLRSVADNLASAWGSTRMGEDIFFKT

Structure information

PDB ID	4bj8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Zebavidin
Assembly ID	1
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	131
Sequence identity between the two chains	1.0
PubMed citation	24204770

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	G
UniProt accession	E7F650	E7F650
Species	7955 (Danio rerio)	7955 (Danio rerio)
Function annotation	BioLiP:4bj8F	BioLiP:4bj8G

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4bj8-a1-m1-cF_4bj8-a1-m1-cG.pdb.gz

Full biological assembly Download: 4bj8-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4bj8/1/1:H/1:E 4bj8/2/1:A/1:D 4bj8/2/1:B/1:C 4bj8/3/1:I/1:L 4bj8/3/1:J/1:K 4bj8/4/1:M/1:P 4bj8/4/1:N/1:O
Other dimers with similar sequences but different poses	4bj8/3/1:I/1:J 4bj8/1/1:F/1:E 4bj8/1/1:H/1:G 4bj8/2/1:B/1:A 4bj8/2/1:C/1:D 4bj8/3/1:K/1:L 4bj8/4/1:N/1:M 4bj8/4/1:P/1:O 4bj8/1/1:F/1:H 4bj8/2/1:A/1:C 4bj8/2/1:B/1:D 4bj8/3/1:I/1:K 4bj8/4/1:N/1:P