4bj8/3/1:I/1:J

Sequences
>4bj8-a3-m1-cI (length=119) [Search sequence]
SSCNVTGVWRNELGSTLRVKAEGSEVRGVYQTAVESTRGAAGHHRSARIIGMVSDGTQPT
VSFSVLWEKGSCSAWVGQCFILDDGAQVLKTFWMLRSVADNLASAWGSTRMGEDIFFKT
>4bj8-a3-m1-cJ (length=119) [Search sequence]
SSCNVTGVWRNELGSTLRVKAEGSEVRGVYQTAVESTRGAAGHHRSARIIGMVSDGTQPT
VSFSVLWEKGSCSAWVGQCFILDDGAQVLKTFWMLRSVADNLASAWGSTRMGEDIFFKT
Structure information
PDB ID 4bj8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Zebavidin
Assembly ID 3
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 24204770
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I J
UniProt accession E7F650 E7F650
Species 7955 (Danio rerio) 7955 (Danio rerio)
Function annotation BioLiP:4bj8I BioLiP:4bj8J
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4bj8-a3-m1-cI_4bj8-a3-m1-cJ.pdb.gz
Full biological assembly
Download: 4bj8-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4bj8/1/1:F/1:E 4bj8/1/1:H/1:G 4bj8/2/1:B/1:A 4bj8/2/1:C/1:D 4bj8/3/1:K/1:L 4bj8/4/1:N/1:M 4bj8/4/1:P/1:O
Other dimers with similar sequences but different poses
  • 4bj8/1/1:F/1:G 4bj8/1/1:H/1:E 4bj8/2/1:A/1:D 4bj8/2/1:B/1:C 4bj8/3/1:I/1:L 4bj8/3/1:J/1:K 4bj8/4/1:M/1:P 4bj8/4/1:N/1:O
  • 4bj8/1/1:F/1:H 4bj8/2/1:A/1:C 4bj8/2/1:B/1:D 4bj8/3/1:I/1:K 4bj8/4/1:N/1:P
  • [Back to Home]