4bjs/1/1:D/1:A

Sequences

>4bjs-a1-m1-cD (length=49) [Search sequence]

LHFFSKKSRRLVARLRGFTPGDLNGISVEERRNLRIELLDFMMRLEYYS

>4bjs-a1-m1-cA (length=53) [Search sequence]

PSLKVHFFSKKSRRLVARLRGFTPGDLNGISVEERRNLRIELLDFMMRLEYYS

Structure information

PDB ID	4bjs (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Rif1 C-terminal domain (Rif1-CTD) from Saccharomyces cerevisiae
Assembly ID	1
Resolution	1.94Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	24
Sequence identity between the two chains	0.98

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	P29539	P29539
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4bjs-a1-m1-cD_4bjs-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4bjs-assembly1.cif.gz

Similar dimers