4bjs/1/1:D/1:B

Sequences
>4bjs-a1-m1-cD (length=49) [Search sequence]
LHFFSKKSRRLVARLRGFTPGDLNGISVEERRNLRIELLDFMMRLEYYS
>4bjs-a1-m1-cB (length=55) [Search sequence]
PSLKVHFFSKKSRRLVARLRGFTPGDLNGISVEERRNLRIELLDFMMRLEYYSNR
Structure information
PDB ID 4bjs (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Rif1 C-terminal domain (Rif1-CTD) from Saccharomyces cerevisiae
Assembly ID 1
Resolution 1.94Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 109
Sequence identity between the two chains 0.98
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D B
UniProt accession P29539 P29539
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4bjs-a1-m1-cD_4bjs-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4bjs-assembly1.cif.gz

[Back to Home]