4bl6/1/1:A/1:D

Sequences

>4bl6-a1-m1-cA (length=78) [Search sequence]

IIVSDTSKLRNELRLLKEDAATFSSLRAFAARCEEYVTQVDDLNRQLEAAEEEKKTLNQL LRLAVQQKLALTQRLEEE

>4bl6-a1-m1-cD (length=81) [Search sequence]

ENEKIIVSDTSKLRNELRLLKEDAATFSSLRAFAARCEEYVTQVDDLNRQLEAAEEEKKT LNQLLRLAVQQKLALTQRLEE

Structure information

PDB ID	4bl6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Bicaudal-D uses a parallel, homodimeric coiled coil with heterotypic registry to co-ordinate recruitment of cargos to dynein
Assembly ID	1
Resolution	2.18Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	107
Sequence identity between the two chains	0.987

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	P16568	P16568
Species	7227 (Drosophila melanogaster)	7227 (Drosophila melanogaster)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4bl6-a1-m1-cA_4bl6-a1-m1-cD.pdb.gz

Full biological assembly Download: 4bl6-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4bl6/1/1:B/1:C 6tzw/1/1:B/1:A
Other dimers with similar sequences but different poses	4bl6/1/1:B/1:D 4bl6/1/1:A/1:C