4bp1/2/1:B/1:C

Sequences

>4bp1-a2-m1-cB (length=280) [Search sequence]

KKWFSEFSIMWPGQAFSLKIKKILYETKSKYQNVLVFESTTYGKVLVLDGVIQLTEKDEF
AYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYF
KNISCGYEDKRVNVFIEDASKFLENVTNTYDVIIVDSSDPIGPAETLFNQNFYEKIYNAL
KPNGYCVAQCESLWIHVGTIKNMIGYAKKLFKKVEYANISIPTYPCGCIGILCCSKTDTG
LTKPNKKLESKEFADLKYYNYENHSAAFKLPAFLLKEIEN

>4bp1-a2-m1-cC (length=281) [Search sequence]

Structure information

PDB ID	4bp1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Plasmodium Falciparum Spermidine Synthase in Complex with 5'-Methylthioadenosine and Putrescine
Assembly ID	2
Resolution	2.17Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	116
Sequence identity between the two chains	1.0
PubMed citation	25760598

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q8II73	Q8II73
Species	36329 (Plasmodium falciparum 3D7)	36329 (Plasmodium falciparum 3D7)
Function annotation	BioLiP:4bp1B	BioLiP:4bp1C

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4bp1-a2-m1-cB_4bp1-a2-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4bp1-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2hte/1/1:A/2:A 2hte/2/1:B/1:C 2i7c/1/1:A/2:A 2i7c/2/1:B/1:C 2pss/1/1:A/2:A 2pss/2/1:B/1:C 2pt6/1/1:A/2:A 2pt6/2/1:B/1:C 2pt9/1/1:A/2:A 2pt9/2/1:B/1:C 2pwp/1/1:A/2:A 2pwp/2/1:B/1:C 3b7p/1/1:A/2:A 3b7p/2/1:B/1:C 3rie/1/1:A/2:A 3rie/2/1:B/1:C 4bp1/1/1:A/2:A 4bp3/1/1:A/2:A 4bp3/2/1:B/1:C 4cwa/1/1:A/2:A 4cwa/2/1:B/1:C 4cxm/1/1:B/1:C 4cxm/2/1:A/2:A 4uoe/1/1:A/2:A 4uoe/2/1:B/1:C 6hy1/1/1:A/2:A 6hy1/2/1:B/1:C 6i1n/1/1:A/2:A 6i1n/2/1:B/1:C