4c5e/1/1:E/1:H

Sequences
>4c5e-a1-m1-cE (length=30) [Search sequence]
GAMASRRWEQKLVHIKTMEGEFSVTMWASG
>4c5e-a1-m1-cH (length=30) [Search sequence]
GAMASRRWEQKLVHIKTMEGEFSVTMWASG
Structure information
PDB ID 4c5e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the minimal Pho-Sfmbt complex (P21 spacegroup)
Assembly ID 1
Resolution 1.951Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E H
UniProt accession Q8ST83 Q8ST83
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4c5e-a1-m1-cE_4c5e-a1-m1-cH.pdb.gz
Full biological assembly
Download: 4c5e-assembly1.cif.gz
Similar dimers

[Back to Home]