4cnz/1/1:A/1:B

Sequences
>4cnz-a1-m1-cA (length=100) [Search sequence]
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGSFLPKVKVEVAVSDDQYEQ
VVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
>4cnz-a1-m1-cB (length=100) [Search sequence]
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGSFLPKVKVEVAVSDDQYEQ
VVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Structure information
PDB ID 4cnz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of PII signaling protein GlnZ from Azospirillum brasilense in complex with adenosine diphosphate
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
PubMed citation 24846646
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P70731 P70731
Species 192 (Azospirillum brasilense) 192 (Azospirillum brasilense)
Function annotation BioLiP:4cnzA BioLiP:4cnzB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4cnz-a1-m1-cA_4cnz-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4cnz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3o5t/1/1:B/2:B 3o5t/1/1:B/3:B 3o5t/1/2:B/3:B 4cny/1/1:A/2:A 4cny/1/1:A/3:A 4cny/1/2:A/3:A 4cnz/1/1:A/1:C 4cnz/1/1:B/1:C 4cnz/2/1:D/1:E 4cnz/2/1:D/1:F 4co4/1/1:A/1:B 4co4/1/1:A/1:C 4co4/1/1:C/1:B 5ovo/1/1:B/2:B 5ovo/1/1:B/3:B 5ovo/1/2:B/3:B

[Back to Home]