4co9/2/1:A/1:B

Sequences

>4co9-a2-m1-cA (length=207) [Search sequence]

TSKWIDISQPLNNDIATWPGDTPFSYEVLWSKEESGSVNVGKLTMSIHTGTHIDAPFHFD
NDGKKVLDLDIQVYVGPTRIIDVSNLESIGKKELEKFHLEGVERLLLRTSSHGKANEFPD
IIPHLRADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILENVVLDHVAD
GDYELIALPLALSDADGSPVRAVIRPI

>4co9-a2-m1-cB (length=207) [Search sequence]

Structure information

PDB ID	4co9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of kynurenine formamidase from Bacillus anthracis
Assembly ID	2
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	169
Sequence identity between the two chains	1.0
PubMed citation	24942958

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q81PP9	Q81PP9
Species	198094 (Bacillus anthracis str. Ames)	198094 (Bacillus anthracis str. Ames)
Function annotation	BioLiP:4co9A	BioLiP:4co9B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4co9-a2-m1-cA_4co9-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4co9-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4co9/1/1:C/1:D 4cz1/1/1:B/1:A 4cz1/2/1:C/1:D