4cq4/1/1:D/1:A

Sequences
>4cq4-a1-m1-cD (length=102) [Search sequence]
ENIASEISKSVEGAIQQVKNLLTLAADRAEQIVNDLASTTTSTITRPIIELSNTADKIAE
GNLEAEVPHQNRADEIGILAKSIERLRRSLKVAMESLEEALK
>4cq4-a1-m1-cA (length=106) [Search sequence]
ANPAENIASEISKSVEGAIQQVKNLLTLAADRAEQIVNDLASTTTSTITRPIIELSNTAD
KIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAMESLEEALK
Structure information
PDB ID 4cq4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title C-terminal fragment of Af1503-sol: transmembrane receptor Af1503 from Archaeoglobus fulgidus engineered for solubility
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession O28769 O28769
Species 2234 (Archaeoglobus fulgidus) 2234 (Archaeoglobus fulgidus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4cq4-a1-m1-cD_4cq4-a1-m1-cA.pdb.gz
Full biological assembly
Download: 4cq4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4cq4/1/1:B/1:C 4gn0/3/1:C/2:B 4gn0/3/2:D/1:A
Other dimers with similar sequences but different poses
  • 4cq4/1/1:C/1:D 4cq4/1/1:B/1:A 4gn0/1/1:C/1:A 4gn0/2/1:D/1:B 4gn0/3/1:C/1:A 4gn0/3/2:D/2:B
  • 4cq4/1/1:B/1:D 4cq4/1/1:C/1:A 4gn0/3/1:C/2:D 4gn0/3/2:B/1:A
  • [Back to Home]