4d1l/2/2:B/1:A

Sequences
>4d1l-a2-m2-cB (length=37) [Search sequence]
EIFTLQVRGRERYEILKKLNDSLELSDVVPASDAEKY
>4d1l-a2-m1-cA (length=38) [Search sequence]
EIFTLQVRGRERYEILKKLNDSLELSDVVPASDAEKYR
Structure information
PDB ID 4d1l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Tetramerization domain of zebrafish p53 (crystal form I)
Assembly ID 2
Resolution 1.97Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession G1K2L5 G1K2L5
Species 7955 (Danio rerio) 7955 (Danio rerio)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4d1l-a2-m2-cB_4d1l-a2-m1-cA.pdb.gz
Full biological assembly
Download: 4d1l-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4d1l/1/1:F/1:D 4d1l/2/1:B/2:A 4d1m/1/1:H/1:E 4d1m/2/1:A/1:D 4d1m/3/1:I/1:L 4d1m/3/1:J/1:K
Other dimers with similar sequences but different poses
  • 4cz6/1/1:C/1:B 4cz5/1/1:A/1:D 4cz5/1/1:B/1:C 4cz6/1/1:A/1:D 4cz7/1/1:A/1:D 4cz7/1/1:C/1:B
  • 4d1l/2/2:B/2:A 4cz5/1/1:B/1:A 4cz5/1/1:D/1:C 4cz6/1/1:C/1:D 4cz7/1/1:A/1:B 4cz7/1/1:C/1:D 4d1l/1/1:C/1:D 4d1l/2/1:B/1:A 4d1m/1/1:F/1:E 4d1m/2/1:A/1:B 4d1m/2/1:D/1:C 4d1m/3/1:I/1:J 4d1m/3/1:L/1:K
    		•

    [Back to Home]