4d2h/1/1:E/1:H

Sequences

>4d2h-a1-m1-cE (length=30) [Search sequence]

DFKDLWTKLKECHDREVQGLQVKVTKLKQE

>4d2h-a1-m1-cH (length=33) [Search sequence]

DFKDLWTKLKECHDREVQGLQVKVTKLKQERIL

Structure information

PDB ID	4d2h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the tetramerisation domain of human CtIP
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	13
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	H
UniProt accession	Q99708	Q99708
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4d2h-a1-m1-cE_4d2h-a1-m1-cH.pdb.gz

Full biological assembly Download: 4d2h-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4d2h/1/1:G/1:F 4d2h/2/1:D/1:A
Other dimers with similar sequences but different poses	4d2h/2/1:D/1:C 4d2h/1/1:E/1:F 4d2h/1/1:H/1:G 4d2h/2/1:B/1:A 4d2h/2/1:D/1:B 4d2h/1/1:E/1:G 4d2h/1/1:H/1:F