4d2h/2/1:D/1:C

Sequences
>4d2h-a2-m1-cD (length=30) [Search sequence]
DFKDLWTKLKECHDREVQGLQVKVTKLKQE
>4d2h-a2-m1-cC (length=34) [Search sequence]
DFKDLWTKLKECHDREVQGLQVKVTKLKQERILD
Structure information
PDB ID 4d2h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the tetramerisation domain of human CtIP
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q99708 Q99708
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4d2h-a2-m1-cD_4d2h-a2-m1-cC.pdb.gz
Full biological assembly
Download: 4d2h-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4d2h/1/1:E/1:F 4d2h/1/1:H/1:G 4d2h/2/1:B/1:A
Other dimers with similar sequences but different poses
  • 4d2h/2/1:D/1:B 4d2h/1/1:E/1:G 4d2h/1/1:H/1:F
  • 4d2h/1/1:E/1:H 4d2h/1/1:G/1:F 4d2h/2/1:D/1:A
    		•

    [Back to Home]