4d3h/1/1:C/1:B

Sequences
>4d3h-a1-m1-cC (length=101) [Search sequence]
SGLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDD
RVDEILSVINQTCGNREQLVSPVEVGGATVFVMPVDAFHQF
>4d3h-a1-m1-cB (length=104) [Search sequence]
GLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDR
VDEILSVINQTCGNREQLVSPIPVEVEVGGATVFVMPVDAFHQF
Structure information
PDB ID 4d3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of PstA
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 72
Sequence identity between the two chains 0.99
PubMed citation 25505271
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession Q2G229 Q2G229
Species 1280 (Staphylococcus aureus) 1280 (Staphylococcus aureus)
Function annotation BioLiP:4d3hC BioLiP:4d3hB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4d3h-a1-m1-cC_4d3h-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4d3h-assembly1.cif.gz

[Back to Home]