4d8a/3/1:B/3:B

Sequences
>4d8a-a3-m1-cB (length=252) [Search sequence]
KWDYDLRCGEYTLNLNEKTLIMGILNSYNEVDAAVRHAKEMRDEGAHIIDIGSVEEEIKR
VVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPI
ILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRN
LEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMS
RMAKMMDAMIGK
>4d8a-a3-m3-cB (length=252) [Search sequence]
KWDYDLRCGEYTLNLNEKTLIMGILNSYNEVDAAVRHAKEMRDEGAHIIDIGSVEEEIKR
VVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPI
ILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRN
LEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMS
RMAKMMDAMIGK
Structure information
PDB ID 4d8a (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of B. anthracis DHPS with compound 21
Assembly ID 3
Resolution 2.183Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 89
Sequence identity between the two chains 1.0
PubMed citation 22416048
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession Q81VW8 Q81VW8
Species 191218 (Bacillus anthracis str. A2012) 191218 (Bacillus anthracis str. A2012)
Function annotation BioLiP:4d8aB BioLiP:4d8aB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4d8a-a3-m1-cB_4d8a-a3-m3-cB.pdb.gz
Full biological assembly
Download: 4d8a-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1tws/1/1:A/2:A 1tws/3/1:B/3:B 1tww/1/1:A/2:A 1tww/3/1:B/3:B 1twz/1/1:A/2:A 1twz/3/1:B/3:B 1tx0/1/1:A/2:A 1tx0/2/1:B/3:B 1tx2/1/1:A/2:A 1tx2/3/1:A/2:A 1tx2/3/3:B/4:B 1tx2/4/1:B/5:B 3h21/1/1:A/2:A 3h21/2/1:B/3:B 3h22/1/1:A/2:A 3h22/2/1:B/3:B 3h23/1/1:A/2:A 3h23/2/1:B/3:B 3h24/1/1:A/2:A 3h24/2/1:B/3:B 3h26/1/1:A/2:A 3h26/2/1:B/3:B 3h2a/1/1:A/2:A 3h2a/2/1:B/3:B 3h2c/1/1:A/2:A 3h2c/2/1:B/3:B 3h2e/1/1:A/2:A 3h2e/2/1:B/3:B 3h2f/1/1:A/2:A 3h2f/2/1:B/3:B 3h2m/1/1:A/2:A 3h2m/2/1:B/3:B 3h2n/1/1:A/2:A 3h2n/2/1:B/3:B 3h2o/1/1:A/2:A 3h2o/2/1:B/3:B 3tya/1/1:A/2:A 3tya/2/1:B/3:B 3tyb/1/1:A/2:A 3tyb/2/1:B/3:B 3tyc/1/1:A/2:A 3tyc/2/1:B/3:B 3tyd/1/1:A/2:A 3tyd/2/1:B/3:B 3tye/1/1:A/2:A 3tye/2/1:B/3:B 3v5o/1/1:A/2:A 3v5o/2/1:B/3:B 3v5o/3/1:B/3:B 3v5o/3/4:A/5:A 4d8a/1/1:A/2:A 4d8a/2/1:B/3:B 4d8a/3/4:A/5:A 4d8z/1/1:A/2:A 4d8z/2/1:B/3:B 4d8z/3/1:B/3:B 4d8z/3/4:A/5:A 4d9p/1/1:A/2:A 4d9p/2/1:B/3:B 4d9p/3/1:A/2:A 4d9p/3/4:B/5:B 4daf/1/1:A/2:A 4daf/2/1:B/3:B 4dai/1/1:A/2:A 4dai/2/1:B/3:B 4db7/1/1:A/2:A 4db7/2/1:B/3:B 4nhv/1/1:A/2:A 4nhv/2/1:B/3:B 4nhv/3/1:A/2:A 4nhv/3/4:B/5:B 4nil/1/1:A/2:A 4nil/2/1:B/3:B 4nil/3/1:A/2:A 4nil/3/4:B/5:B 4nir/1/1:A/2:A 4nir/2/1:B/3:B 4nir/3/1:A/2:A 4nir/3/4:B/5:B 4nl1/1/1:A/2:A 4nl1/2/1:B/3:B
Other dimers with similar sequences but different poses
  • 4nhv/3/5:B/1:A 1tx2/3/3:B/2:A 1tx2/3/4:B/1:A 3v5o/3/1:B/5:A 3v5o/3/3:B/4:A 4d8a/3/1:B/5:A 4d8a/3/3:B/4:A 4d8z/3/1:B/5:A 4d8z/3/3:B/4:A 4d9p/3/4:B/2:A 4d9p/3/5:B/1:A 4nhv/3/4:B/2:A 4nil/3/4:B/2:A 4nil/3/5:B/1:A 4nir/3/4:B/2:A 4nir/3/5:B/1:A
  • [Back to Home]