4dam/2/1:F/1:E

Sequences
>4dam-a2-m1-cF (length=110) [Search sequence]
MNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWDREKNAWTDGHTNFFTVWANRQ
LATNASGSLAVGDPVVVQGRLKVRTDVREGQSRTSADIDAVAIGHDLARG
>4dam-a2-m1-cE (length=112) [Search sequence]
SMNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWDREKNAWTDGHTNFFTVWANR
QLATNASGSLAVGDPVVVQGRLKVRTDVREGQSRTSADIDAVAIGHDLARGT
Structure information
PDB ID 4dam (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor
Assembly ID 2
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 71
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession Q9KYI9 Q9KYI9
Species 1902 (Streptomyces coelicolor) 1902 (Streptomyces coelicolor)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4dam-a2-m1-cF_4dam-a2-m1-cE.pdb.gz
Full biological assembly
Download: 4dam-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4dam/1/1:B/1:A 4dam/3/1:J/1:I 4dam/3/1:L/1:K
Other dimers with similar sequences but different poses
  • 4dam/3/1:L/1:I 4dam/1/1:C/1:B 4dam/1/1:D/1:A 4dam/2/1:G/1:F 4dam/2/1:H/1:E 4dam/3/1:J/1:K
  • [Back to Home]