4dam/2/1:G/1:H

Sequences
>4dam-a2-m1-cG (length=98) [Search sequence]
SMNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWWTDGHTNFFTVWANRQLATNA
SGSLAVGDPVVVQGRLKVRTRTSADIDAVAIGHDLARG
>4dam-a2-m1-cH (length=108) [Search sequence]
MNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWDREAWTDGHTNFFTVWANRQLA
TNASGSLAVGDPVVVQGRLKVRTDVREGQSRTSADIDAVAIGHDLARG
Structure information
PDB ID 4dam (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor
Assembly ID 2
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession Q9KYI9 Q9KYI9
Species 1902 (Streptomyces coelicolor) 1902 (Streptomyces coelicolor)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4dam-a2-m1-cG_4dam-a2-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4dam-assembly2.cif.gz

[Back to Home]