4dn9/2/2:B/2:A

Sequences
>4dn9-a2-m2-cB (length=94) [Search sequence]
SYGLIGKRATPGQRDALIAILVEGASSPGCLSYVVAQDPKDPDAIWITEVWDSPESHKAS
LSLPSVQDAIACGRPLIAALDEHHETVPVGGHGI
>4dn9-a2-m2-cA (length=95) [Search sequence]
SYGLIGKRATPGQRDALIAILVEGASSPGCLSYVVAQDPKDPDAIWITEVWDSPESHKAS
LSLPSVQDAIACGRPLIAALDEHHETVPVGGHGIG
Structure information
PDB ID 4dn9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title CRYSTAL STRUCTURE OF putative Antibiotic biosynthesis monooxygenase from Chloroflexus aurantiacus J-10-fl
Assembly ID 2
Resolution 2.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 106
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession A9WHE0 A9WHE0
Species 324602 (Chloroflexus aurantiacus J-10-fl) 324602 (Chloroflexus aurantiacus J-10-fl)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4dn9-a2-m2-cB_4dn9-a2-m2-cA.pdb.gz
Full biological assembly
Download: 4dn9-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4dn9/1/1:B/1:A 4dn9/2/1:B/1:A

[Back to Home]