4dxe/2/1:D/1:E

Sequences
>4dxe-a2-m1-cD (length=113) [Search sequence]
NAMIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATK
EAFSKALGVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKS
>4dxe-a2-m1-cE (length=113) [Search sequence]
AMIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKE
AFSKALGTVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKS
Structure information
PDB ID 4dxe (database links: RCSB PDB PDBe PDBj PDBsum)
Title 2.52 Angstrom resolution crystal structure of the acyl-carrier-protein synthase (AcpS)-acyl carrier protein (ACP) protein-protein complex from Staphylococcus aureus subsp. aureus COL
Assembly ID 2
Resolution 2.51Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 0.991
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession Q5HED0 Q5HED0
Species 93062 (Staphylococcus aureus subsp. aureus COL) 93062 (Staphylococcus aureus subsp. aureus COL)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4dxe-a2-m1-cD_4dxe-a2-m1-cE.pdb.gz
Full biological assembly
Download: 4dxe-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4dxe/1/1:B/1:A 4dxe/1/1:C/1:A 4jm7/1/1:B/1:C 5cxd/1/1:A/1:B 5cxd/1/1:A/1:C 5cxd/1/1:C/1:B

[Back to Home]