4dyu/1/1:E/1:L

Sequences
>4dyu-a1-m1-cE (length=155) [Search sequence]
ELLYTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTA
LTDHLDTFAERAVQLGGVALGTAQVINDKTPLKSYPTNIHSVQEHLKALAERYAIVANDI
RKAITEVEDENSADMFTAASRDLDKFLWFIESNIE
>4dyu-a1-m1-cL (length=155) [Search sequence]
ELLYTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTA
LTDHLDTFAERAVQLGGVALGTAQVINDKTPLKSYPTNIHSVQEHLKALAERYAIVANDI
RKAITEVEDENSADMFTAASRDLDKFLWFIESNIE
Structure information
PDB ID 4dyu (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of DNA starvation/stationary phase protection protein Dps from Yersinia pestis KIM 10
Assembly ID 1
Resolution 2.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E L
UniProt accession Q7CJ65 Q7CJ65
Species 187410 (Yersinia pestis KIM10+) 187410 (Yersinia pestis KIM10+)
Function annotation BioLiP:4dyuE BioLiP:4dyuL
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4dyu-a1-m1-cE_4dyu-a1-m1-cL.pdb.gz
Full biological assembly
Download: 4dyu-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4dyu/1/1:A/1:H 4dyu/1/1:A/1:K 4dyu/1/1:B/1:F 4dyu/1/1:B/1:J 4dyu/1/1:C/1:E 4dyu/1/1:C/1:L 4dyu/1/1:F/1:J 4dyu/1/1:G/1:D 4dyu/1/1:G/1:I 4dyu/1/1:I/1:D 4dyu/1/1:K/1:H
Other dimers with similar sequences but different poses
  • 4dyu/1/1:G/1:L 4dyu/1/1:A/1:E 4dyu/1/1:A/1:I 4dyu/1/1:B/1:G 4dyu/1/1:B/1:L 4dyu/1/1:C/1:H 4dyu/1/1:C/1:J 4dyu/1/1:E/1:I 4dyu/1/1:F/1:D 4dyu/1/1:F/1:K 4dyu/1/1:J/1:H 4dyu/1/1:K/1:D
  • 4dyu/1/1:E/1:G 4dyu/1/1:B/1:D 4dyu/1/1:C/1:A 4dyu/1/1:F/1:H 4dyu/1/1:I/1:K 4dyu/1/1:J/1:L
  • [Back to Home]