4dz2/3/1:B/2:B

Sequences

>4dz2-a3-m1-cB (length=113) [Search sequence]

STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGG MVIKGWDEGVQGMKVGGVRRLTIPPQLGYGAGGAGGVIPPNATLVFEVELLDV

>4dz2-a3-m2-cB (length=113) [Search sequence]

STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGG MVIKGWDEGVQGMKVGGVRRLTIPPQLGYGAGGAGGVIPPNATLVFEVELLDV

Structure information

PDB ID	4dz2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a Peptidyl-prolyl cis-trans isomerase with surface mutation R92G from Burkholderia pseudomallei complexed with FK506
Assembly ID	3
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	19
Sequence identity between the two chains	1.0
PubMed citation	24366729

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	Q3JK38	Q3JK38
Species	320372 (Burkholderia pseudomallei 1710b)	320372 (Burkholderia pseudomallei 1710b)
Function annotation	BioLiP:4dz2B	BioLiP:4dz2B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4dz2-a3-m1-cB_4dz2-a3-m2-cB.pdb.gz

Full biological assembly Download: 4dz2-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4dz2/1/1:A/2:A 4dz2/2/1:B/2:B 4dz2/3/1:A/2:A 4dz3/1/1:A/1:B
Other dimers with similar sequences but different poses	4dz2/3/1:A/2:B 4dz2/3/1:B/2:A