4e1p/1/1:A/1:B

Sequences
>4e1p-a1-m1-cA (length=55) [Search sequence]
KVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRV
>4e1p-a1-m1-cB (length=56) [Search sequence]
KVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVG
Structure information
PDB ID 4e1p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the dimerization domain of Lsr2 from Mycobacterium tuberculosis in the P 1 21 1 space group
Assembly ID 1
Resolution 1.728Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 97
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P9WIP7 P9WIP7
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4e1p-a1-m1-cA_4e1p-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4e1p-assembly1.cif.gz
Similar dimers

[Back to Home]